PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G439300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 294aa    MW: 31538.2 Da    PI: 7.5008
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G439300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.61.1e-111457445
                       S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                       WT eEd+ + +a +  + +   +Wk+Ia+ ++ g+tl+++k+++ 
  Aqcoe3G439300.2.p 14 WTREEDKAFENALAFTPEDsidRWKKIAEAVP-GKTLEEIKHHYE 57
                       ********************************.**********96 PP

2Myb_DNA-binding40.46.7e-13124168347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT++E+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
  Aqcoe3G439300.2.p 124 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVSRTPTQVASHAQKY 168
                        6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-6758IPR009057Homeodomain-like
PROSITE profilePS512938.222964IPR017884SANT domain
SMARTSM007172.9E-91062IPR001005SANT/Myb domain
SuperFamilySSF466895.74E-121268IPR009057Homeodomain-like
CDDcd001674.81E-91460No hitNo description
PfamPF002498.9E-91457IPR001005SANT/Myb domain
PROSITE profilePS5129417.212116173IPR017930Myb domain
SuperFamilySSF466892.24E-16119174IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-17121171IPR006447Myb domain, plants
SMARTSM007175.5E-10121171IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-10124167IPR009057Homeodomain-like
PfamPF002491.2E-10124168IPR001005SANT/Myb domain
CDDcd001671.77E-9124169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MTTDEEATVH SSLWTREEDK AFENALAFTP EDSIDRWKKI AEAVPGKTLE EIKHHYELLV  60
EDVNSIESGR VPLPCYVSSE DGEEHIGQTK TSKKGGHPGI FHSDSNHGGG KGSRSDQERR  120
KGIAWTEDEH RLFLLGLDKY GKGDWRSISR NFVVSRTPTQ VASHAQKYFI RLNSMNKDRR  180
RSSIHDITSV GNGDVAMPQA PITGQTVLPT AGGSSAKSSK QQSQPPPSGP GVGVYGAPTV  240
GQPVGGPAVG TPVNLSTPGH MAYGMRASLP MVPGAPANMA SMTYSMPHAS AHM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-1914791176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010279472.11e-152PREDICTED: transcription factor DIVARICATA
RefseqXP_010279473.11e-152PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H79e-61DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A068VFI41e-144A0A068VFI4_COFCA; Uncharacterized protein
STRINGGLYMA07G28310.11e-138(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-108MYB family protein